[go: up one dir, main page]

Dopaminski receptor D4 je dopaminski D2-liki G-protein spregnuti receptor koji je kodiran genom DRD4 sa hromosoma 11, regija 11p15.5.[5]

DRD4
Identifikatori
AliasiDRD4
Vanjski ID-jeviOMIM: 126452 MGI: 94926 HomoloGene: 20215 GeneCards: DRD4
Lokacija gena (čovjek)
Hromosom 11 (čovjek)
Hrom.Hromosom 11 (čovjek)[1]
Hromosom 11 (čovjek)
Genomska lokacija za DRD4
Genomska lokacija za DRD4
Bend11p15.5Početak637,269 bp[1]
Kraj640,706 bp[1]
Lokacija gena (miš)
Hromosom 7 (miš)
Hrom.Hromosom 7 (miš)[2]
Hromosom 7 (miš)
Genomska lokacija za DRD4
Genomska lokacija za DRD4
Bend7 F5|7 86.6 cMPočetak140,871,919 bp[2]
Kraj140,876,377 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija signal transducer activity
potassium channel regulator activity
SH3 domain binding
vezivanje identičnih proteina
dopamine neurotransmitter receptor activity
G protein-coupled receptor activity
GO:0001948, GO:0016582 vezivanje za proteine
dopamine binding
dopamine neurotransmitter receptor activity, coupled via Gi/Go
epinephrine binding
norepinephrine binding
vezivanje iona metala
G protein-coupled serotonin receptor activity
neurotransmitter receptor activity
Ćelijska komponenta integral component of membrane
integral component of plasma membrane
membrana
ćelijska membrana
postsynapse
glutamatergic synapse
dendrit
Biološki proces response to amphetamine
rhythmic process
arachidonic acid secretion
regulation of circadian rhythm
positive regulation of dopamine uptake involved in synaptic transmission
GO:0072468 Transdukcija signala
fear response
dopamine metabolic process
behavioral response to ethanol
behavioral response to cocaine
positive regulation of sodium:proton antiporter activity
cellular calcium ion homeostasis
positive regulation of kinase activity
adult locomotory behavior
inhibitory postsynaptic potential
negative regulation of protein secretion
socijalno ponašanje
negative regulation of voltage-gated calcium channel activity
regulation of dopamine metabolic process
response to histamine
behavioral fear response
dopamine receptor signaling pathway
G protein-coupled receptor signaling pathway
adenylate cyclase-inhibiting dopamine receptor signaling pathway
regulation of postsynaptic neurotransmitter receptor internalization
G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
chemical synaptic transmission
G protein-coupled serotonin receptor signaling pathway
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_000797

NM_007878

RefSeq (bjelančevina)

NP_000788

NP_031904

Lokacija (UCSC)Chr 11: 0.64 – 0.64 MbChr 7: 140.87 – 140.88 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Nedavno je objavljena struktura DRD4 u kombinaciji s antipsihotskim lijekom nemonaprid.[6]

Kao i kod drugih podtipova dopaminskih receptora, receptor D4 aktivira neurotransmiter dopamin. Povezan je s mnogim neurvnim i psihijatrijskim stanjima [7] uključujući shizofreniju i bipolarni poremećaj,[8] ADHD,[9][10] addiktivna ponašanja,[11] Parkinsnsonovu bolest,[12] i poremećaj ishrane kao što je anoreksija nervoza.[13] Nađena je slaba povezanost između DRD4 i graničnog poremećaja ličnosti.

Također je meta lijekova koji liječe shizofreniju i Parkinsonovu bolest.[14] Receptor D4 smatra se sličnim D2, u kojem aktivirani receptor inhibira enzim adenilat-ciklaza, čime se smanjuje unutarćelijska koncentracija drugog glasnika cAMPa.[15]

Aminokiselinska sekvenca

uredi

Dužina polipeptidnog lanca je 467 aminokiselina, a molekulska težina 48.361 Da.[16].

1020304050
MGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLA
GNSLVCVSVATERALQTPTNSFIVSLAAADLLLALLVLPLFVYSEVQGGA
WLLSPRLCDALMAMDVMLCTASIFNLCAISVDRFVAVAVPLRYNRQGGSR
RQLLLIGATWLLSAAVAAPVLCGLNDVRGRDPAVCRLEDRDYVVYSSVCS
FFLPCPLMLLLYWATFRGLQRWEVARRAKLHGRAPRRPSGPGPPSPTPPA
PRLPQDPCGPDCAPPAPGLPRGPCGPDCAPAAPGLPPDPCGPDCAPPAPG
LPQDPCGPDCAPPAPGLPRGPCGPDCAPPAPGLPQDPCGPDCAPPAPGLP
PDPCGSNCAPPDAVRAAALPPQTPPQTRRRRRAKITGRERKAMRVLPVVV
GAFLLCWTPFFVVHITQALCPACSVPPRLVSAVTWLGYVNSALNPVIYTV
FNAEFRNVFRKALRACC

Genetika

uredi

Ljudski protein je kodiran DRD4 na hromosom 11 nalazi sw na sekvenci u 11p15,5.[17]

Postoje male varijacije (mutacije/polimorfizmi) u ljudskom genu:

Mutacije u ovom genu povezane su s različitim fenotipovima ponašanja, uključujući disfunkciju autonomnog nervnog sistema, poremećaj pažnje/hiperaktivnosti,[20] shizofreniju[21] and the personality trait of novelty seeking.[22]

Također pogledajte

uredi

Reference

uredi
  1. ^ a b c ENSG00000276825 GRCh38: Ensembl release 89: ENSG00000069696, ENSG00000276825 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000025496 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Van Tol HH, Bunzow JR, Guan HC, Sunahara RK, Seeman P, Niznik HB, Civelli O (april 1991). "Cloning of the gene for a human dopamine D4 receptor with high affinity for the antipsychotic clozapine". Nature. 350 (6319): 610–4. Bibcode:1991Natur.350..610V. doi:10.1038/350610a0. PMID 1840645. S2CID 4244670.
  6. ^ Wang S, Wacker D, Levit A, Che T, Betz RM, McCorvy JD, Venkatakrishnan AJ, Huang XP, Dror RO, Shoichet BK, Roth BL (oktobar 2017). "D4 dopamine receptor high-resolution structures enable the discovery of selective agonists". Science. 358 (6361): 381–386. Bibcode:2017Sci...358..381W. doi:10.1126/science.aan5468. PMC 5856174. PMID 29051383.
  7. ^ Ptácek R, Kuzelová H, Stefano GB (septembar 2011). "Dopamine D4 receptor gene DRD4 and its association with psychiatric disorders". Medical Science Monitor. 17 (9): RA215–20. doi:10.12659/MSM.881925. PMC 3560519. PMID 21873960.
  8. ^ Domschke K (juli 2013). "Clinical and molecular genetics of psychotic depression". Schizophrenia Bulletin. 39 (4): 766–75. doi:10.1093/schbul/sbt040. PMC 3686457. PMID 23512949.
  9. ^ LaHoste GJ, Swanson JM, Wigal SB, Glabe C, Wigal T, King N, Kennedy JL (maj 1996). "Dopamine D4 receptor gene polymorphism is associated with attention deficit hyperactivity disorder". Molecular Psychiatry. 1 (2): 121–4. PMID 9118321.
  10. ^ Smalley SL, Bailey JN, Palmer CG, Cantwell DP, McGough JJ, Del'Homme MA, Asarnow JR, Woodward JA, Ramsey C, Nelson SF (septembar 1998). "Evidence that the dopamine D4 receptor is a susceptibility gene in attention deficit hyperactivity disorder". Molecular Psychiatry. 3 (5): 427–30. doi:10.1038/sj.mp.4000457. PMID 9774776.
  11. ^ McGeary J (septembar 2009). "The DRD4 exon 3 VNTR polymorphism and addiction-related phenotypes: a review". Pharmacology Biochemistry and Behavior. 93 (3): 222–9. doi:10.1016/j.pbb.2009.03.010. PMC 2706302. PMID 19336242.
  12. ^ Cormier F, Muellner J, Corvol JC (april 2013). "Genetics of impulse control disorders in Parkinson's disease". Journal of Neural Transmission. 120 (4): 665–71. doi:10.1007/s00702-012-0934-4. PMID 23232665. S2CID 21967333.
  13. ^ Rask-Andersen M, Olszewski PK, Levine AS, Schiöth HB (mart 2010). "Molecular mechanisms underlying anorexia nervosa: focus on human gene association studies and systems controlling food intake". Brain Research Reviews. 62 (2): 147–64. doi:10.1016/j.brainresrev.2009.10.007. PMID 19931559. S2CID 37635456.
  14. ^ Ptáček R, Kuželová H, Stefano GB, Raboch J, Kream RM (april 2013). "Targeted D4 dopamine receptors: implications for drug discovery and therapeutic development". Current Drug Targets. 14 (4): 507–12. doi:10.2174/1389450111314040012. PMID 23469923.
  15. ^ Neve KA, Seamans JK, Trantham-Davidson H (august 2004). "Dopamine receptor signaling". Journal of Receptor and Signal Transduction Research. 24 (3): 165–205. CiteSeerX 10.1.1.465.5011. doi:10.1081/RRS-200029981. PMID 15521361. S2CID 12407397.
  16. ^ "UniProt, P21917". Pristupljeno 21. 8. 2021.
  17. ^ Van Tol HH, Wu CM, Guan HC, Ohara K, Bunzow JR, Civelli O, Kennedy J, Seeman P, Niznik HB, Jovanovic V (juli 1992). "Multiple dopamine D4 receptor variants in the human population". Nature. 358 (6382): 149–52. Bibcode:1992Natur.358..149T. doi:10.1038/358149a0. PMID 1319557. S2CID 4345839.
  18. ^ Catalano M, Nobile M, Novelli E, Nöthen MM, Smeraldi E (oktobar 1993). "Distribution of a novel mutation in the first exon of the human dopamine D4 receptor gene in psychotic patients". Biological Psychiatry. 34 (7): 459–64. doi:10.1016/0006-3223(93)90236-7. PMID 8268330. S2CID 34841647.
  19. ^ Rondou P, Haegeman G, Van Craenenbroeck K (juni 2010). "The dopamine D4 receptor: biochemical and signalling properties". Cellular and Molecular Life Sciences. 67 (12): 1971–86. doi:10.1007/s00018-010-0293-y. PMID 20165900. S2CID 21432517.
  20. ^ Thapar A, Langley K, Owen MJ, O'Donovan MC (decembar 2007). "Advances in genetic findings on attention deficit hyperactivity disorder". Psychological Medicine. 37 (12): 1681–92. doi:10.1017/S0033291707000773. PMID 17506925.
  21. ^ Gene Overview of All Published Schizophrenia-Association Studies for DRD4 Arhivirano 21. 2. 2009. na Wayback Machine – SzGene database at Schizophrenia Research Forum.
  22. ^ Munafò MR, Yalcin B, Willis-Owen SA, Flint J (januar 2008). "Association of the dopamine D4 receptor (DRD4) gene and approach-related personality traits: meta-analysis and new data". Biological Psychiatry. 63 (2): 197–206. doi:10.1016/j.biopsych.2007.04.006. PMID 17574217. S2CID 28997438.

Vanjski linkovi

uredi